5/ 10
ivvvaaannaaalaaawiiiiifamilly.blogspot.com
Be careful
Caution

A few signals deserve attention. Check carefully before you share anything or pay.

This score can be wrong — a safe site can look suspicious and a scammer can (still) look safe. Always stay careful.

▸Visitor reports (0)
  • No reports yet. Be the first.
5
views
0
reported safe
0
reported scam
What can you do?
  • Be careful before you share details or pay.
  • Check the web address is exactly right.
  • In doubt? Look the organisation up yourself and contact them that way.
What is your experience?
Have you dealt with this address? Let others know.

What we found
  • Website does not respond (timeout) (+1)
  • This address is on blogspot.com, a free website builder or hosting service: anyone can create an address like this. That does not mean it is a scam, but it does mean you should take extra care (+2)
  • Extremely long domain name (+1)
Technical details
Domain registereddoes not apply: this is an address on blogspot.com
Secure connection (SSL)unknown (no answer)
Server142.251.39.129 · AS15169
CountryUnited States
ProviderGOOGLE - Google LLC
Mail serverno

Please noteThis is an automated assessment based on public sources and visitor reports — not conclusive proof. A safe website or number can wrongly appear suspicious, and a scammer can (still) appear safe. Always use your own judgement and be careful with payments, logins and codes. Something wrong — are you the owner, or do you know more? Tell us at info@isditveilig.nl and we will look into it.

↻ Check another