7/10
ivvvaaannaaalaaawiiiiifamilly.blogspot.com
This domain is known for scams or abuse
Danger

Our sources have flagged this domain. Do not share details, do not log in and do not pay here.

5
views
0
reported safe
0
reported scam
What should you do?
  • Do not share logins, DigiD, bank details or verification codes.
  • Do not pay and do not click links or QR codes from this domain.
  • Unsure about a message? Contact the organisation via a number or app you already know.
  • Already shared details? Call your bank immediately and report it to the police and your national fraud desk.
What is your experience?
Have you dealt with this address? Let others know.

Visitor reports (0)
  • No reports yet. Be the first.

Our data is historical. Run a fresh, live check:

↻ Check this domain live now
The evidence
  • Flagged by OpenPhish as phishing, first seen 2026-09-04
  • Extremely long domain name (+1)
Technical details
SourceOpenPhish
Threat typephishing
First seen2026-09-04
Last seen2026-09-04
Malicious links seen2
IP address74.125.205.132

This is an automated assessment based on public sources, not conclusive proof. Use your own judgement. In doubt? Contact the organisation through a channel you already know.